Are you over 18 and want to see adult content?
More Annotations
A complete backup of schweigerderm.com
Are you over 18 and want to see adult content?
A complete backup of bourgoisediteur.fr
Are you over 18 and want to see adult content?
A complete backup of texasboxoffice.com
Are you over 18 and want to see adult content?
Favourite Annotations
A complete backup of https://newscorp.com
Are you over 18 and want to see adult content?
A complete backup of https://mediafax.ro
Are you over 18 and want to see adult content?
A complete backup of https://casualclaire.com
Are you over 18 and want to see adult content?
A complete backup of https://firsturl.de
Are you over 18 and want to see adult content?
A complete backup of https://google.co.vi
Are you over 18 and want to see adult content?
A complete backup of https://litepanels.com
Are you over 18 and want to see adult content?
A complete backup of https://pellegrom.me
Are you over 18 and want to see adult content?
A complete backup of https://naapimha.org
Are you over 18 and want to see adult content?
A complete backup of https://freeprnow.com
Are you over 18 and want to see adult content?
A complete backup of https://esnikesol.org
Are you over 18 and want to see adult content?
A complete backup of https://naimies.com
Are you over 18 and want to see adult content?
A complete backup of https://artillry.co
Are you over 18 and want to see adult content?
Text
GWDG OWNCLOUD
With the service “GWDG ownCloud“ we offer sync and share functionalities with the software “ownCloud Enterprise“. The web-office suite “ONLYOFFICE“ can open and edit the usual office types. The service is operated on mass storage in our own datacentres.
NETZE - GWDG - IT IN DER WISSENSCHAFT Andreas Ißleiber. Leiter der Arbeitsgruppe. Telefon: 0551 201-1815 E-Mail: andreas.issleiber@gwdg.de Orest Umudumov. Stellvertretender Leiter der Arbeitsgruppe. Telefon: 0551 39-61619 INDEX OF /~COMPBIOL/UNICLUST/2020_06 uniclust##_yyyy_mm_consensus.fasta: Consensus sequences of every cluster in FASTA format. The sequence header starts with the Uniclust cluster identifier uc##-yymm-, the UniProt accession code of the representative sequence, the size of the cluster, the up to 5 best functional annotations from cluster members, and UniProt identifiersof
GWDG JUPYTER CLOUD
Usage. Jupyter Cloud is intended for individual use like prototyping code, learning a new language or run a small scale example of a program, especially for courses and lectures. For problems and tasks that require more than the allotted quota of storage, high number of CPU cores or large amounts of RAM please consider using our HPCservices
E-MAIL-SERVICE (MS EXCHANGE) TRANSLATE THIS PAGE Steht für die Anbindung an den Exchange Server der GWDG kein geeigneter E-Mail-Klient zur Verfügung, empfiehlt sich der Zugang über das Web-Interface OWA (Outlook Web App) an. . Um mit OWA auf Ihre E-Mails zuzugreifen, rufen Sie den den Link https://email.gwdg.de auf (für Studierende der Universität Göttingen: https://email.stud.uni-goettingen.de), der zur Anmeldeseite desExchange
GEOREM - DATABASE ON GEOCHEMICAL, ENVIRONMENTAL AND GeoReM is a Max Planck Institute database for reference materials of geological and environmental interest, such as rock powders, synthetic and natural glasses as well as mineral, isotopic, biological, river water and seawater reference materials. GeoReM contains published analytical data and compilation values (major and trace element concentrations and mass fractions, radiogenic and stable HEDGEDOC - COLLABORATIVE MARKDOWN NOTES The best platform to write and share markdown. Do you really want to delete your user account? This will delete your account, all notes that are owned by you and remove all references to HOMEPAGE OF CHENCHANG ZHU IN GOTTINGEN, MATHEMATISCHES Phone: +49 0551 39 7799. Address: Mathematisches Institut, Bunsenstr. 3-5. Gottingen, 37073 Germany. Hi:), this is Chenchang Zhu. I've got tenured in at Mathematischen Institut der Georg-August-Universitat Gottingen (since 2013), and before moving to Gottingen (in 2008), I was Maitre de conferences (assistant professor) in Fourier InstituteMICROSNIPER
Enter SNP id (e.g. rs1051765): Choose one RefSeq id. Press NEXTbutton.
GWDG - GWDG - IT IN DER WISSENSCHAFTSERVICESPKIHARDWARE PURCHASEONLINE SURVEYSVIRTUAL SERVEROFFERS Through our own research in the field of computer science and participation in numerous research projects, we create the basis for innovative, customer-oriented IT solutions. Our staff is available to help with all questions concerning scientific data processing, withGWDG OWNCLOUD
With the service “GWDG ownCloud“ we offer sync and share functionalities with the software “ownCloud Enterprise“. The web-office suite “ONLYOFFICE“ can open and edit the usual office types. The service is operated on mass storage in our own datacentres.
NETZE - GWDG - IT IN DER WISSENSCHAFT Andreas Ißleiber. Leiter der Arbeitsgruppe. Telefon: 0551 201-1815 E-Mail: andreas.issleiber@gwdg.de Orest Umudumov. Stellvertretender Leiter der Arbeitsgruppe. Telefon: 0551 39-61619 INDEX OF /~COMPBIOL/UNICLUST/2020_06 uniclust##_yyyy_mm_consensus.fasta: Consensus sequences of every cluster in FASTA format. The sequence header starts with the Uniclust cluster identifier uc##-yymm-, the UniProt accession code of the representative sequence, the size of the cluster, the up to 5 best functional annotations from cluster members, and UniProt identifiersof
GWDG JUPYTER CLOUD
Usage. Jupyter Cloud is intended for individual use like prototyping code, learning a new language or run a small scale example of a program, especially for courses and lectures. For problems and tasks that require more than the allotted quota of storage, high number of CPU cores or large amounts of RAM please consider using our HPCservices
E-MAIL-SERVICE (MS EXCHANGE) TRANSLATE THIS PAGE Steht für die Anbindung an den Exchange Server der GWDG kein geeigneter E-Mail-Klient zur Verfügung, empfiehlt sich der Zugang über das Web-Interface OWA (Outlook Web App) an. . Um mit OWA auf Ihre E-Mails zuzugreifen, rufen Sie den den Link https://email.gwdg.de auf (für Studierende der Universität Göttingen: https://email.stud.uni-goettingen.de), der zur Anmeldeseite desExchange
GEOREM - DATABASE ON GEOCHEMICAL, ENVIRONMENTAL AND GeoReM is a Max Planck Institute database for reference materials of geological and environmental interest, such as rock powders, synthetic and natural glasses as well as mineral, isotopic, biological, river water and seawater reference materials. GeoReM contains published analytical data and compilation values (major and trace element concentrations and mass fractions, radiogenic and stable HEDGEDOC - COLLABORATIVE MARKDOWN NOTES The best platform to write and share markdown. Do you really want to delete your user account? This will delete your account, all notes that are owned by you and remove all references to HOMEPAGE OF CHENCHANG ZHU IN GOTTINGEN, MATHEMATISCHES Phone: +49 0551 39 7799. Address: Mathematisches Institut, Bunsenstr. 3-5. Gottingen, 37073 Germany. Hi:), this is Chenchang Zhu. I've got tenured in at Mathematischen Institut der Georg-August-Universitat Gottingen (since 2013), and before moving to Gottingen (in 2008), I was Maitre de conferences (assistant professor) in Fourier InstituteMICROSNIPER
Enter SNP id (e.g. rs1051765): Choose one RefSeq id. Press NEXTbutton.
SUPPORT - GWDG - IT IN DER WISSENSCHAFT Maintenance. The computer services are operated 24/7. The only exceptions are for necessary maintenance of systems. The time for planned maintenance work is on Thursday 17.00 until 19.00 o'clock. In urgent cases (e.g. critical security updates) this might differ. Finddetails of
SOFTWARE AND LICENCE MANAGEMENT Our Offer. We maintain a number of framework and campus agreements with major software manufacturers and suppliers from which the software and licenses can be obtained also in smaller numbers. We handle for you the procurement of licenses required. We can engage in contract negotiations and demand analysis. Access licenses can also bemanaged
HPC - GWDG - IT IN DER WISSENSCHAFT In addition to IT operations, one of the GWDG's main areas of activity is research and science. This is underlined by the various projects and the chairs of Prof. Dr. Ramin Yahyapour and Prof. Dr. Philipp Wieder. The HPC team is also commited to the promotion of young scientists by supporting teaching and supervising master and doctoraltheses.
ESCIENCE - GWDG - IT IN DER WISSENSCHAFT Prof. Dr. Philipp Wieder. Leiter der Arbeitsgruppe Stellvertretender Leiter GWDG. Telefon: 0551 201-1576 E-Mail: philipp.wieder@gwdg.de Dr. Sven Bingert. Stellvertretender Leiter der Arbeitsgruppe MICROSOFT KEY MANAGEMENT SERVICE (KMS) Microsoft Key Management Service (KMS) After the installation of a Microsoft software product, the software has to be activated. In the past, the software activation had to be done directly by Microsoft by entering a so called “Multiple Activation Key” (MAK). This activation can also be done by the GWDG 's KMS server for everycomputer of
19TH OPEN SCIENCE GÖTTINGEN MEET-UP ON 21 JUNE 2021 # 19th Open Science Göttingen Meet-up on 21 June 2021 ## Open Science & Services in a Nutshell @ Gö HIGH PERFORMANCE COMPUTING The following documentation is valid for this list of hardware: Explanation: Systems marked with an asterisk (*) are only available for research groups participating in the corresponding hosting agreement. GB = Gigabyte, TB = Terabyte, Gb/s = Gigabit per second, GHz = Gigahertz, GT/s = Giga transfer per second, IB = Infiniband, QDR= Quad data
HEDGEDOC - COLLABORATIVE MARKDOWN NOTES The best platform to write and share markdown. Do you really want to delete your user account? This will delete your account, all notes that are owned by you and remove all references to REDEMPTION SONG« RASTAFARI BOB MARLEY & THE WAILERS Incense (Ganja) Illustration von Tennyson Smith »I myself and you in your way, together we are but fragments of the One. The many are but fractions of H.I.M.1, this One, the Whole of Creation. Us being fractions of Creation’s Whole, within the tranquility of ourselveslies
HOMEPAGE OF NUNO M ROMÃO The Homepage of Nuno M Romão. 08.07.2015: Asymptotic geometry in moduli of nonlinear Abelian vortices, Informal Geometric Analysis Seminar, MPIM, Bonn, Germany 23.04.2015: Geometry and topology of toric gauged sigma-models, Oberseminar Differentialgeometrie, Leibniz University of Hanover, Germany 07.04.2015: Divisor braids and gauge theory, Mathematical Physics Seminar, DAMTP, GWDG - GWDG - IT IN DER WISSENSCHAFTSERVICESPKIHARDWARE PURCHASEONLINE SURVEYSVIRTUAL SERVEROFFERS Through our own research in the field of computer science and participation in numerous research projects, we create the basis for innovative, customer-oriented IT solutions. Our staff is available to help with all questions concerning scientific data processing, with SUPPORT - GWDG - IT IN DER WISSENSCHAFTABOUT USCAREER OPPORTUNITIES Maintenance. The computer services are operated 24/7. The only exceptions are for necessary maintenance of systems. The time for planned maintenance work is on Thursday 17.00 until 19.00 o'clock. In urgent cases (e.g. critical security updates) this might differ. Finddetails of
GWDG OWNCLOUD
With the service “GWDG ownCloud“ we offer sync and share functionalities with the software “ownCloud Enterprise“. The web-office suite “ONLYOFFICE“ can open and edit the usual office types. The service is operated on mass storage in our own datacentres.
NETZE - GWDG - IT IN DER WISSENSCHAFT Andreas Ißleiber. Leiter der Arbeitsgruppe. Telefon: 0551 201-1815 E-Mail: andreas.issleiber@gwdg.de Orest Umudumov. Stellvertretender Leiter der Arbeitsgruppe. Telefon: 0551 39-61619 MICROSOFT KEY MANAGEMENT SERVICE (KMS) Microsoft Key Management Service (KMS) After the installation of a Microsoft software product, the software has to be activated. In the past, the software activation had to be done directly by Microsoft by entering a so called “Multiple Activation Key” (MAK). This activation can also be done by the GWDG 's KMS server for everycomputer of
E-MAIL-SERVICE (MS EXCHANGE) TRANSLATE THIS PAGE Steht für die Anbindung an den Exchange Server der GWDG kein geeigneter E-Mail-Klient zur Verfügung, empfiehlt sich der Zugang über das Web-Interface OWA (Outlook Web App) an. . Um mit OWA auf Ihre E-Mails zuzugreifen, rufen Sie den den Link https://email.gwdg.de auf (für Studierende der Universität Göttingen: https://email.stud.uni-goettingen.de), der zur Anmeldeseite desExchange
HEDGEDOC - COLLABORATIVE MARKDOWN NOTES The best platform to write and share markdown. Do you really want to delete your user account? This will delete your account, all notes that are owned by you and remove all references to GEOREM - DATABASE ON GEOCHEMICAL, ENVIRONMENTAL AND GeoReM is a Max Planck Institute database for reference materials of geological and environmental interest, such as rock powders, synthetic and natural glasses as well as mineral, isotopic, biological, river water and seawater reference materials. GeoReM contains published analytical data and compilation values (major and trace element concentrations and mass fractions, radiogenic and stable HOMEPAGE OF CHENCHANG ZHU IN GOTTINGEN, MATHEMATISCHES Phone: +49 0551 39 7799. Address: Mathematisches Institut, Bunsenstr. 3-5. Gottingen, 37073 Germany. Hi:), this is Chenchang Zhu. I've got tenured in at Mathematischen Institut der Georg-August-Universitat Gottingen (since 2013), and before moving to Gottingen (in 2008), I was Maitre de conferences (assistant professor) in Fourier InstituteMICROSNIPER
Enter SNP id (e.g. rs1051765): Choose one RefSeq id. Press NEXTbutton.
GWDG - GWDG - IT IN DER WISSENSCHAFTSERVICESPKIHARDWARE PURCHASEONLINE SURVEYSVIRTUAL SERVEROFFERS Through our own research in the field of computer science and participation in numerous research projects, we create the basis for innovative, customer-oriented IT solutions. Our staff is available to help with all questions concerning scientific data processing, with SUPPORT - GWDG - IT IN DER WISSENSCHAFTABOUT USCAREER OPPORTUNITIES Maintenance. The computer services are operated 24/7. The only exceptions are for necessary maintenance of systems. The time for planned maintenance work is on Thursday 17.00 until 19.00 o'clock. In urgent cases (e.g. critical security updates) this might differ. Finddetails of
GWDG OWNCLOUD
With the service “GWDG ownCloud“ we offer sync and share functionalities with the software “ownCloud Enterprise“. The web-office suite “ONLYOFFICE“ can open and edit the usual office types. The service is operated on mass storage in our own datacentres.
NETZE - GWDG - IT IN DER WISSENSCHAFT Andreas Ißleiber. Leiter der Arbeitsgruppe. Telefon: 0551 201-1815 E-Mail: andreas.issleiber@gwdg.de Orest Umudumov. Stellvertretender Leiter der Arbeitsgruppe. Telefon: 0551 39-61619 MICROSOFT KEY MANAGEMENT SERVICE (KMS) Microsoft Key Management Service (KMS) After the installation of a Microsoft software product, the software has to be activated. In the past, the software activation had to be done directly by Microsoft by entering a so called “Multiple Activation Key” (MAK). This activation can also be done by the GWDG 's KMS server for everycomputer of
E-MAIL-SERVICE (MS EXCHANGE) TRANSLATE THIS PAGE Steht für die Anbindung an den Exchange Server der GWDG kein geeigneter E-Mail-Klient zur Verfügung, empfiehlt sich der Zugang über das Web-Interface OWA (Outlook Web App) an. . Um mit OWA auf Ihre E-Mails zuzugreifen, rufen Sie den den Link https://email.gwdg.de auf (für Studierende der Universität Göttingen: https://email.stud.uni-goettingen.de), der zur Anmeldeseite desExchange
HEDGEDOC - COLLABORATIVE MARKDOWN NOTES The best platform to write and share markdown. Do you really want to delete your user account? This will delete your account, all notes that are owned by you and remove all references to GEOREM - DATABASE ON GEOCHEMICAL, ENVIRONMENTAL AND GeoReM is a Max Planck Institute database for reference materials of geological and environmental interest, such as rock powders, synthetic and natural glasses as well as mineral, isotopic, biological, river water and seawater reference materials. GeoReM contains published analytical data and compilation values (major and trace element concentrations and mass fractions, radiogenic and stable HOMEPAGE OF CHENCHANG ZHU IN GOTTINGEN, MATHEMATISCHES Phone: +49 0551 39 7799. Address: Mathematisches Institut, Bunsenstr. 3-5. Gottingen, 37073 Germany. Hi:), this is Chenchang Zhu. I've got tenured in at Mathematischen Institut der Georg-August-Universitat Gottingen (since 2013), and before moving to Gottingen (in 2008), I was Maitre de conferences (assistant professor) in Fourier InstituteMICROSNIPER
Enter SNP id (e.g. rs1051765): Choose one RefSeq id. Press NEXTbutton.
SUPPORT - GWDG - IT IN DER WISSENSCHAFT Maintenance. The computer services are operated 24/7. The only exceptions are for necessary maintenance of systems. The time for planned maintenance work is on Thursday 17.00 until 19.00 o'clock. In urgent cases (e.g. critical security updates) this might differ. Finddetails of
SOFTWARE AND LICENCE MANAGEMENT Our Offer. We maintain a number of framework and campus agreements with major software manufacturers and suppliers from which the software and licenses can be obtained also in smaller numbers. We handle for you the procurement of licenses required. We can engage in contract negotiations and demand analysis. Access licenses can also bemanaged
ONLINE SURVEYS
Our Offer. We operate a server hosting the reliable and popular open- source software “LimeSurvey”. With LimeSurvey, it is possible to create, conduct and analyze online surveys. The data collected will be stored in the MySQL Cluster of the GWDG. NETZE - GWDG - IT IN DER WISSENSCHAFT Andreas Ißleiber. Leiter der Arbeitsgruppe. Telefon: 0551 201-1815 E-Mail: andreas.issleiber@gwdg.de Orest Umudumov. Stellvertretender Leiter der Arbeitsgruppe. Telefon: 0551 39-61619 JUPYTER - GWDG - IT IN DER WISSENSCHAFT We operate the service “Jupyter“ which allows for live editing and execution of text, graphs, equations and code in a web browser. Possible use cases are data cleaning and transformation, numeric simulations, statistic modelling, machine learning, and coding courses. Jupyter can also be operated on the Scientific ComputeCluster of the GWDG
GWDG PROJECT MANAGEMENT SERVICE The GWDG Project Management Service is part of the GWDG online tool collection for the management of your projects. With this self-service you can customize your projects according to your requirements and embed them into your development environment. You can focus on your project and we monitor, maintain, and backup the service. MICROSOFT CAMPUS AGREEMENT TRANSLATE THIS PAGE Software für Studierende. Studierende können Microsoft 365 mit Office im Rahmen des Campus Agreements ab dem 01.05.2021 über das Kundenportal der GWDG beziehen: Anmeldung am Kundenportal der GWDG: www.gwdg.de. In der Kontoverwaltung ( Mein Konto) unter Externe Dienste auf Bearbeiten klicken. Microsoft 365 / Office aktivierenklicken.
REDEMPTION SONG« RASTAFARI BOB MARLEY & THE WAILERS Incense (Ganja) Illustration von Tennyson Smith »I myself and you in your way, together we are but fragments of the One. The many are but fractions of H.I.M.1, this One, the Whole of Creation. Us being fractions of Creation’s Whole, within the tranquility of ourselveslies
HOMEPAGE OF CHENCHANG ZHU IN GOTTINGEN, MATHEMATISCHES Hi:), this is Chenchang Zhu. I've got tenured in at Mathematischen Institut der Georg-August-Universitat Gottingen (since 2013), and before moving to Gottingen (in 2008), I was Maitre de conferences (assistant professor) in Fourier Institute, Grenoble (from 2006), post-doc in ETH Zurich (2004-2006) with Giovanni Felder, Ph.D. from U.C. Berkeley with advisor Alan Weinstein (2004), undergraduate CISCO ANYCONNECT (WINDOWS) TRANSLATE THIS PAGE Bei gleichzeitiger Verwendung von Apple Bonjour für Windows kann es zu Verbindungsproblemen mit den Cisco AnyConnect kommen() .Die Internetverbindungsfreigabe (internet-connection-sharing) darf unter Windows bei der Verwendung des Cisco AnyConnect-Clients nicht aktiviert sein.. Falls Ihnen Probleme begegnen und Sie Hilfe benötigen, wenden Sie sich bitte an unseren Support. GWDG - GWDG - IT IN DER WISSENSCHAFTSERVICESPKIHARDWARE PURCHASEONLINE SURVEYSVIRTUAL SERVEROFFERS Excellent research and teaching require a powerful, innovative IT infrastructure. As the university computing centre for the Georg-August-Universität Göttingen, and as a computing and IT competence centre for the Max Planck Society, we offer a wide range of information and communication services for science.. Through our own research in the field of computer science and participation inGWDG OWNCLOUD
Your Requirement. You would like to keep your data in sync on every device and also be able to work offline with it. Additionally you may want to give other persons (inside and outside of the Max Planck Society respectively the University of Göttingen) access to selectedfiles.
MICROSOFT KEY MANAGEMENT SERVICE (KMS) To make a KMS activation work you have to use an installation medium form Microsoft's Campus or Microsoft Select program. KMS is the default activation process for these installation media.GWDG JUPYTER CLOUD
Jupyter Cloud is intended for individual use like prototyping code, learning a new language or run a small scale example of a program, especially for courses and lectures. E-MAIL-SERVICE (MS EXCHANGE) Steht für die Anbindung an den Exchange Server der GWDG kein geeigneter E-Mail-Klient zur Verfügung, empfiehlt sich der Zugang über das Web-Interface OWA (Outlook Web App) an. . Um mit OWA auf Ihre E-Mails zuzugreifen, rufen Sie den den Link https://email.gwdg.de auf (für Studierende der Universität Göttingen: https://email.stud.uni-goettingen.de), der zur Anmeldeseite desExchange
HEDGEDOC - COLLABORATIVE MARKDOWN NOTESCODIMD DOCKERCODIMD DOCKERMARKDOWN KNOWLEDGE BASE The best platform to write and share markdown. Do you really want to delete your user account? This will delete your account, all notes that are owned by you and remove all references to GEOREM - DATABASE ON GEOCHEMICAL, ENVIRONMENTAL ANDGEOREM DATABASEGEOROC DATABASEGEOCHEMICAL DATABASEROCK DATABASE GeoReM is a Max Planck Institute database for reference materials of geological and environmental interest, such as rock powders, synthetic and natural glasses as well as mineral, isotopic, biological, river water and seawater reference materials. GeoReM contains published analytical data and compilation values (major and trace element concentrations and mass fractions, radiogenic and stable WILLKOMMEN AUF GWDG MEET. Willkommen auf GWDG Meet ein Webkonferenzsystem zur digitalen Forschung und Lehre. Schauen Sie sich unsere Anleitung zur Verwendungvon GWDG Meet an
HOMEPAGE OF CHENCHANG ZHU IN GOTTINGEN, MATHEMATISCHES Hi:), this is Chenchang Zhu. I've got tenured in at Mathematischen Institut der Georg-August-Universitat Gottingen (since 2013), and before moving to Gottingen (in 2008), I was Maitre de conferences (assistant professor) in Fourier Institute, Grenoble (from 2006), post-doc in ETH Zurich (2004-2006) with Giovanni Felder, Ph.D. from U.C. Berkeley with advisor Alan Weinstein (2004), undergraduateMICROSNIPER
Assembly: GRCh37/hg19 Enter Gene Name (e.g. DISC1) or RefSeq id (e.g. NM_001025076): Choose one RefSeq id. Press NEXT button. GWDG - GWDG - IT IN DER WISSENSCHAFTSERVICESPKIHARDWARE PURCHASEONLINE SURVEYSVIRTUAL SERVEROFFERS Excellent research and teaching require a powerful, innovative IT infrastructure. As the university computing centre for the Georg-August-Universität Göttingen, and as a computing and IT competence centre for the Max Planck Society, we offer a wide range of information and communication services for science.. Through our own research in the field of computer science and participation inGWDG OWNCLOUD
Your Requirement. You would like to keep your data in sync on every device and also be able to work offline with it. Additionally you may want to give other persons (inside and outside of the Max Planck Society respectively the University of Göttingen) access to selectedfiles.
MICROSOFT KEY MANAGEMENT SERVICE (KMS) To make a KMS activation work you have to use an installation medium form Microsoft's Campus or Microsoft Select program. KMS is the default activation process for these installation media.GWDG JUPYTER CLOUD
Jupyter Cloud is intended for individual use like prototyping code, learning a new language or run a small scale example of a program, especially for courses and lectures. E-MAIL-SERVICE (MS EXCHANGE) Steht für die Anbindung an den Exchange Server der GWDG kein geeigneter E-Mail-Klient zur Verfügung, empfiehlt sich der Zugang über das Web-Interface OWA (Outlook Web App) an. . Um mit OWA auf Ihre E-Mails zuzugreifen, rufen Sie den den Link https://email.gwdg.de auf (für Studierende der Universität Göttingen: https://email.stud.uni-goettingen.de), der zur Anmeldeseite desExchange
HEDGEDOC - COLLABORATIVE MARKDOWN NOTESCODIMD DOCKERCODIMD DOCKERMARKDOWN KNOWLEDGE BASE The best platform to write and share markdown. Do you really want to delete your user account? This will delete your account, all notes that are owned by you and remove all references to GEOREM - DATABASE ON GEOCHEMICAL, ENVIRONMENTAL ANDGEOREM DATABASEGEOROC DATABASEGEOCHEMICAL DATABASEROCK DATABASE GeoReM is a Max Planck Institute database for reference materials of geological and environmental interest, such as rock powders, synthetic and natural glasses as well as mineral, isotopic, biological, river water and seawater reference materials. GeoReM contains published analytical data and compilation values (major and trace element concentrations and mass fractions, radiogenic and stable WILLKOMMEN AUF GWDG MEET. Willkommen auf GWDG Meet ein Webkonferenzsystem zur digitalen Forschung und Lehre. Schauen Sie sich unsere Anleitung zur Verwendungvon GWDG Meet an
HOMEPAGE OF CHENCHANG ZHU IN GOTTINGEN, MATHEMATISCHES Hi:), this is Chenchang Zhu. I've got tenured in at Mathematischen Institut der Georg-August-Universitat Gottingen (since 2013), and before moving to Gottingen (in 2008), I was Maitre de conferences (assistant professor) in Fourier Institute, Grenoble (from 2006), post-doc in ETH Zurich (2004-2006) with Giovanni Felder, Ph.D. from U.C. Berkeley with advisor Alan Weinstein (2004), undergraduateMICROSNIPER
Assembly: GRCh37/hg19 Enter Gene Name (e.g. DISC1) or RefSeq id (e.g. NM_001025076): Choose one RefSeq id. Press NEXT button. ACADEMY - GWDG - IT IN DER WISSENSCHAFT Participation. The GWDG-Academy offers its services to employees of all institutions of the University of Göttingen, the Max Planck Society and scientific institutions that SUPPORT - GWDG - IT IN DER WISSENSCHAFT Opening Times. The user work area and the service hotline is available: Monday to Friday from 7.00 - 21:00 o'clock Saturday and Sunday from 10.00 - 18:00 o'clockONLINE SURVEYS
Your Requirement. You would like to conduct online surveys and store the gathered data at a trustworthy site in Germany. The creation of the surveys should be easy and offer many design options. SOFTWARE AND LICENCE MANAGEMENT Your Advantages. You can use the software in many cases immediately. You do not have to carry out tendering and procurement procedures. You save the time-consuming negotiations with software vendors andsuppliers.
NETZE - GWDG - IT IN DER WISSENSCHAFT Andreas Ißleiber. Leiter der Arbeitsgruppe. Telefon: 0551 201-1815 E-Mail: andreas.issleiber@gwdg.de Orest Umudumov. Stellvertretender Leiter der Arbeitsgruppe. Telefon: 0551 39-61619 JUPYTER - GWDG - IT IN DER WISSENSCHAFT Your Advantages. Easy web-based environment ; LaTeX and Markdown support ; Kernel available in Python, Julia, and R ; Export to PDF,HTML, and Markdown
GWDG PROJECT MANAGEMENT SERVICE Powered by OpenProjectOpenProject MICROSOFT CAMPUS AGREEMENT Das Präsidium der Universität hat auf seiner Sitzung am 28.04.2021 beschlossen, dass die gesamte Universität Göttingen, einschließlich Universitätsmedizin, dem Bundesrahmenvertrag über ein Campus Agreement der Firma Microsoft beitreten soll. HOMEPAGE OF CHENCHANG ZHU IN GOTTINGEN, MATHEMATISCHES Hi:), this is Chenchang Zhu. I've got tenured in at Mathematischen Institut der Georg-August-Universitat Gottingen (since 2013), and before moving to Gottingen (in 2008), I was Maitre de conferences (assistant professor) in Fourier Institute, Grenoble (from 2006), post-doc in ETH Zurich (2004-2006) with Giovanni Felder, Ph.D. from U.C. Berkeley with advisor Alan Weinstein (2004), undergraduate CISCO ANYCONNECT (WINDOWS) Bei gleichzeitiger Verwendung von Apple Bonjour für Windows kann es zu Verbindungsproblemen mit den Cisco AnyConnect kommen() .Die Internetverbindungsfreigabe (internet-connection-sharing) darf unter Windows bei der Verwendung des Cisco AnyConnect-Clients nicht aktiviert sein.. Falls Ihnen Probleme begegnen und Sie Hilfe benötigen, wenden Sie sich bitte an unseren Support.____
*
* __ Sign In
* News
* Services
* Go Back
* Services
* Storage Services
* Go Back
* Storage Services
* Data Archiving
* Backup
* File Service
* GWDG ownCloud
* Cryptshare
* Email & Collaboration* Go Back
* Email & Collaboration * E-Mail Service (MS Exchange 2016) * Spam and Virus Filtering* Mailing Lists
* MS SharePoint
* Managed Services
* Project Management Service* GWDG Pad
* ShareLaTeX
* Rocket.Chat
* GWDG Web Office
* GitLab
* Server Services
* Go Back
* Server Services
* Virtual Server
* Housing of Servers* Web Hosting
* GWDG Cloud Server
* FTP Server
* Network Services
* Go Back
* Network Services
* IP Address Management System* System Monitoring
* Setting up eduroam * Integration into the Active Directory * User Management with OpenLDAP * Client Management for Windows * Client-Management for macOS and iOS * Application Services* Go Back
* Application Services * Persistent Identifier (PID) * Library Service Aleph * Library Service Koha* Databases
* Application and Registration Services * Plagiarism Prevention* Online Surveys
* Bioinformatics Programs * Statistics Programs* Jupyter
* Pseudonymisation and Data Trusteeship* IT Security
* Go Back
* IT Security
* Vulnerability Scans on Network-attached Equipment * Public Key Infrastructure (PKI) * Virus Protection (Sophos Update Service)* General Services
* Go Back
* General Services
* Videoconferencing
* Identity and Access Management * Identity and Access Management * Single Sign-on (SSO) / Authentication and Authorization Infrastructure (AAI) * Software and Licence Management * Computer Lending Pool * Print & Scan Services* URL Shortener
* IT Consulting
* Go Back
* IT Consulting
* Scientific Data Management* IT Security
* Hardware Purchase
* Apple Support Centre * Establishing Directory Services (AD, LDAP) * Planning of Data Transmission Networks * Research & Education* Go Back
* Research & Education* Projects
* Go Back
* Projects
* BexIS++
* CLARIN-D
* CleanSky
* DARIAH-DE
* EGI ENGAGE
* eLabour
* GenePaint
* GFBio
* GRAcE
* HDC
* JOINTLY
* koala
* MIKELANGELO
* NEPHELE
* Profit-HPC
* RADAR
* SENDATE
* SFB 755
* SWZ
* SFB 990
* Up2U
* Göttingen eResearch Alliance* Collaborations
* Go Back
* Collaborations
* Archival Cultural Heritage Online* Teaching
* Go Back
* Teaching
* Thesis Projects
* Parallel Computing * PC on Parallel Computing* Service Computing
* Oberseminar
* Web Security and Cryptography* Publications
* Go Back
* Publications
* GWDG Reports
* Library
* HPC
* Employees
* About Us
* Go Back
* About Us
* Organization
* Go Back
* Organization
* Shareholders and Committees* Management
* Groups
* Works Council
* Mission Statement
* Company Regulations* Go Back
* Company Regulations* Code of Conduct
* Gender Guideline
* Mobile Working
* Accessible IT
* Press Releases
* Go Back
* Press Releases
* 2021
* 2020
* 2019
* 2018
* 2017
* 2016
* 2015
* 2014
* 2013
* 2012
* 2011
* 2010
* Contact
* Go Back
* Contact
* Map
* Faculty Account Manager * Institute Account Manager* Career
* Go Back
* Career
* Ausbildung
* Purchase
* Go Back
* Purchase
* Supplementary Contract Terms * Additional Contract Terms * Self-certification for Qualification* Buyer Profile
* Data Collection
* Computer Museum
* Service Catalog
* GWDG News
* Go Back
* GWDG News
* 44. Jahrgang, 2021 * 43. Jahrgang, 2020 * 42. Jahrgang, 2019 * 41. Jahrgang, 2018 * 40. Jahrgang, 2017 * 39. Jahrgang, 2016 * 38. Jahrgang, 2015 * 37. Jahrgang, 2014 * 36. Jahrgang, 2013 * 35. Jahrgang, 2012 * 34. Jahrgang, 2011 * 33. Jahrgang, 2010* Archiv
* Academy
* Support
__
EN DE
* Menu
Cookies and Tracking help us to give you a better experience on our website. Read More OKPrevious
We provide some typical tools and services for mobile workMOBILE WORK
A simple platform for team or one-on-one communication and filesharingROCKET.CHAT
Is your link too long and confusing? You can use this service toshorten it.
URL SHORTENER
Find out more about our High Performance Computing servicesHPC
Issue 5/2021 of the GWDG News availableGWDG NEWS
We provide some typical tools and services for mobile workMOBILE WORK
A simple platform for team or one-on-one communication and filesharingROCKET.CHAT
Is your link too long and confusing? You can use this service toshorten it.
URL SHORTENER
Find out more about our High Performance Computing servicesHPC
Next
Rocket.Chat
HPC
Videoconferencing
ownCloud
EXCELLENT RESEARCH AND TEACHING REQUIRE A POWERFUL, INNOVATIVE ITINFRASTRUCTURE
As the university computing centre for the Georg-August-Universität Göttingen , and as a computing and IT competence centre for the Max Planck Society , we offer a wide range of information and communication services for science. Through our own research in the field of computer science and participation in numerous research projects, we create the basis for innovative, customer-oriented IT solutions. Our staff is available to help with all questions concerning scientific data processing, with an extensive range of advice andsupport services.
HINWEISE ZU COVID-19 Unsere Hinweise zur aktuellen Situation sind hier zu finden.
Über Möglichkeiten und unterstützende Tools zum mobilen Arbeiten informieren wir hier . Das Rechenzentrum bleibt für den Publikumsverkehr nach wie vor bis auf Weiteres GESCHLOSSEN.TOP NEWS __
03.05.2021 / 18:19
IT Security Awareness Days from 07.06. – 18.06.202126.05.2021 / 11:34
Computer Senses: Digital Exhibition of the University of Göttingen25.05.2021 / 19:04
System architects and developers (m/f/d) wantedMore ..
OPERATING NEWS __
03.06.2021 / 14:00
Warning: Phishing e-mail circulating31.05.2021 / 17:36
Maintenance: urgent security updates on the DHCP servers29.05.2021 / 16:11
Maintenance completed: SharePointMore ..
Overview
Status overview on key services__
* GWDG /
SERVICE HOTLINE +49 551 201-1523 / support@gwdg.deSupport
GWDG
* GWDG News
* Events
* Career Opportunities * Terms and Conditions* Service Catalog
* Account and Service Request Forms* Offers
* New here?
SERVICES
* Storage Services
* Email & Collaboration* Server Services
* Network Services
* Application Services* IT Security
* General Services
* IT Consulting
RESEARCH & EDUCATION* Research Foci
* Projects
* Göttingen eResearch Alliance* Collaborations
* Teaching
* Publications
* Library
* HPC
* Employees
CONTACT
* How to reach us
Gesellschaft für wissenschaftliche Datenverarbeitung mbH Göttingen| v2.2.2
INTERNAL IMPRINT
PRIVACY NOTICE
SITEMAP
__
__
Details
Copyright © 2024 ArchiveBay.com. All rights reserved. Terms of Use | Privacy Policy | DMCA | 2021 | Feedback | Advertising | RSS 2.0