Are you over 18 and want to see adult content?
More Annotations
![A complete backup of www.vintagemags.org](https://www.archivebay.com/archive5/images/2131effb-f211-4a8c-9dad-5b73ad074302.png)
A complete backup of www.vintagemags.org
Are you over 18 and want to see adult content?
![A complete backup of www.ls-models.gr](https://www.archivebay.com/archive5/images/313dcd96-25c7-4c30-9dd3-74b65275eb58.png)
A complete backup of www.ls-models.gr
Are you over 18 and want to see adult content?
![A complete backup of www.literotica.com](https://www.archivebay.com/archive5/images/3337d530-01f1-4f0c-bfaf-e53899115c2e.png)
A complete backup of www.literotica.com
Are you over 18 and want to see adult content?
![A complete backup of www.www.anonib.com](https://www.archivebay.com/archive5/images/1dab8ed8-c93e-4929-9dc7-4d54c2ef7d6f.png)
A complete backup of www.www.anonib.com
Are you over 18 and want to see adult content?
![A complete backup of www.www.barravipsrio.com](https://www.archivebay.com/archive5/images/dba0c0bc-2f71-4e45-bd48-28656592dea3.png)
A complete backup of www.www.barravipsrio.com
Are you over 18 and want to see adult content?
![A complete backup of www.asiaerotica.com](https://www.archivebay.com/archive5/images/85fafd89-7933-4042-be96-cda7b260fb5b.png)
A complete backup of www.asiaerotica.com
Are you over 18 and want to see adult content?
Favourite Annotations
![A complete backup of jumpfrompaper.com](https://www.archivebay.com/archive2/923bdabd-1482-4ae8-b4cd-2cf4f3491fdb.png)
A complete backup of jumpfrompaper.com
Are you over 18 and want to see adult content?
![A complete backup of arizonaarchery.com](https://www.archivebay.com/archive2/d9d86667-dded-4590-bb15-b8b8320103cb.png)
A complete backup of arizonaarchery.com
Are you over 18 and want to see adult content?
![A complete backup of travelyesplease.com](https://www.archivebay.com/archive2/201d477b-f2d3-4e7b-923a-6e9fba146952.png)
A complete backup of travelyesplease.com
Are you over 18 and want to see adult content?
Text
RECIPES ARCHIVES
Vegan Double Chocolate Cookies. Blueberry Banana Baked Oatmeal. Banana Bread Protein Bars. Top 20 Most-Loved Hummusapien Recipes of All Time. Flourless Apple Cinnamon Muffins. Amazing Minestrone Soup. Mint Chocolate Energy Bites. Sweet Potato Black Bean Burgers with Cilantro Yogurt Sauce. Healthy Morning Glory Muffins. YOUR TOP 10 FAVORITE RECIPES FROM 2020 What. A. Year. In 2020, I canceled my wedding (and honeymoon) twice. got married in my living room. helped launch Alchemy Meal Prep. closed and reopened restaurants. turned 30. got pregnant. had the stomach flu during my virtual baby shower. spent a month in the hospital. cried a lot. THE BEST VEGAN BROCCOLI SALAD EVER Blend until completely smooth and creamy. Place broccoli, grapes, almonds, red onion, and dried cranberries in a medium or large mixing bowl. Add dressing and toss thoroughly to coat. Season with salt and pepper to taste. Serve chilled. The Best Vegan 12 HEALTHY CACAO RECIPES THAT WILL MAKE YOU LOVE YOURSELF I always buy this cacoa powder because it's organic, affordable, and because Terra Soul is a family run company that I love. Now go crazy for cacao with me and make some yummy noms! ONE BOWL VEGAN CHOCOLATE ZUCCHINI BANANA BREAD. CREAMY CHOCOLATE BLUEBERRY SHAKE. FLOURLESS PEANUT BUTTER ZUCCHINI BROWNIES. VEGAN PEPPERMINT CHOCOLATE SKILLET INCREDIBLE VEGAN BANANA BREAD--SUPER MOIST, SIMPLE TO MAKEVEGAN LASAGNA RECIPE HUMMUSAPIENVEGAN CHOCOLATE BANANA BREADVEGAN CHOCOLATE CHUNK BANANA BREADVEGAN CHOCOLATE BREAD RECIPETHE BEST VEGAN LASAGNA HUMMUSAPIENVEGAN BANANA BREAD NO OIL Bake for 1 hour and 10 minutes (1 hour and 15 minutes for maple syrup version), or until a knife comes out clean. If your loaf looks like it's getting too browned, quickly slide a piece of tin foil on top after 50 minutes. Once done, carefully remove from pan FLUFFY ORANGE MUFFINS 2 large eggs, ideally at room temperature. 1 tsp vanilla extract. Instructions. Preheat the oven to 425°F and grease a muffin tin. Stir together flour, sugar, baking powder, and salt in a large mixing bowl. In a medium bowl or liquid measuring cup, whisk together yogurt, oil, orange juice, vanilla, and eggs. CREAMY VEGAN BROCCOLI CAULIFLOWER SOUP Instructions. Heat oil in a soup pot or Dutch oven over medium heat. Add onion, ½ tsp salt, and a grind of pepper and sauté for 5 minutes, or until softened. Add garlic and cook for another minute. Add carrots, broccoli, cauliflower, and potato and sauté EASY HEALTHY OVERNIGHT STEEL CUT OATMEAL RECIPE How to Make Overnight Steel Cut Oatmeal. Full of fiber, plant protein, and whole grain goodness, Overnight Steel Cut Oatmeal is a GLORIOUS way to start the day, especially when the full Tupperware is ready to go and all you have to do is throw it in EASY VEGAN BLACK BEAN BURGERS Place beans in a large bowl. Mash with a potato masher or fork until most beans are broken up, leaving some whole beans in tact. Add breadcrumbs, onion powder, garlic powder, cumin, chili powder, smoked paprika, salt, pepper, sriarcha, and flax mixture. Stir until well combined. Form into 5-6 tightly-packed patties. HOME - HUMMUSAPIENRECIPESWELLNESSLIFESTYLEALCHEMYFAQBREAKFAST Welcome to Hummusapien, a fantastical food blog brimming with nourishing (always delish!) recipes from a Registered Dietitian plus lifestyle tidbits to inspire you to live your most joyful, balanced life. Grab a super hot cup o' joe and let's get cookin'.RECIPES ARCHIVES
Vegan Double Chocolate Cookies. Blueberry Banana Baked Oatmeal. Banana Bread Protein Bars. Top 20 Most-Loved Hummusapien Recipes of All Time. Flourless Apple Cinnamon Muffins. Amazing Minestrone Soup. Mint Chocolate Energy Bites. Sweet Potato Black Bean Burgers with Cilantro Yogurt Sauce. Healthy Morning Glory Muffins. YOUR TOP 10 FAVORITE RECIPES FROM 2020 What. A. Year. In 2020, I canceled my wedding (and honeymoon) twice. got married in my living room. helped launch Alchemy Meal Prep. closed and reopened restaurants. turned 30. got pregnant. had the stomach flu during my virtual baby shower. spent a month in the hospital. cried a lot. THE BEST VEGAN BROCCOLI SALAD EVER Blend until completely smooth and creamy. Place broccoli, grapes, almonds, red onion, and dried cranberries in a medium or large mixing bowl. Add dressing and toss thoroughly to coat. Season with salt and pepper to taste. Serve chilled. The Best Vegan 12 HEALTHY CACAO RECIPES THAT WILL MAKE YOU LOVE YOURSELF I always buy this cacoa powder because it's organic, affordable, and because Terra Soul is a family run company that I love. Now go crazy for cacao with me and make some yummy noms! ONE BOWL VEGAN CHOCOLATE ZUCCHINI BANANA BREAD. CREAMY CHOCOLATE BLUEBERRY SHAKE. FLOURLESS PEANUT BUTTER ZUCCHINI BROWNIES. VEGAN PEPPERMINT CHOCOLATE SKILLET INCREDIBLE VEGAN BANANA BREAD--SUPER MOIST, SIMPLE TO MAKEVEGAN LASAGNA RECIPE HUMMUSAPIENVEGAN CHOCOLATE BANANA BREADVEGAN CHOCOLATE CHUNK BANANA BREADVEGAN CHOCOLATE BREAD RECIPETHE BEST VEGAN LASAGNA HUMMUSAPIENVEGAN BANANA BREAD NO OIL Bake for 1 hour and 10 minutes (1 hour and 15 minutes for maple syrup version), or until a knife comes out clean. If your loaf looks like it's getting too browned, quickly slide a piece of tin foil on top after 50 minutes. Once done, carefully remove from pan FLUFFY ORANGE MUFFINS 2 large eggs, ideally at room temperature. 1 tsp vanilla extract. Instructions. Preheat the oven to 425°F and grease a muffin tin. Stir together flour, sugar, baking powder, and salt in a large mixing bowl. In a medium bowl or liquid measuring cup, whisk together yogurt, oil, orange juice, vanilla, and eggs. CREAMY VEGAN BROCCOLI CAULIFLOWER SOUP Instructions. Heat oil in a soup pot or Dutch oven over medium heat. Add onion, ½ tsp salt, and a grind of pepper and sauté for 5 minutes, or until softened. Add garlic and cook for another minute. Add carrots, broccoli, cauliflower, and potato and sauté EASY HEALTHY OVERNIGHT STEEL CUT OATMEAL RECIPE How to Make Overnight Steel Cut Oatmeal. Full of fiber, plant protein, and whole grain goodness, Overnight Steel Cut Oatmeal is a GLORIOUS way to start the day, especially when the full Tupperware is ready to go and all you have to do is throw it in EASY VEGAN BLACK BEAN BURGERS Place beans in a large bowl. Mash with a potato masher or fork until most beans are broken up, leaving some whole beans in tact. Add breadcrumbs, onion powder, garlic powder, cumin, chili powder, smoked paprika, salt, pepper, sriarcha, and flax mixture. Stir until well combined. Form into 5-6 tightly-packed patties. THE BEST VEGAN LASAGNA 7 - 10 cups marinara sauce (2-2 5oz jars, I like mine saucy!) For the tofu ricotta: 2 - 14 oz pkg extra firm tofu, drained and pressed. 10oz tub roasted garlic hummus ( 1 heaping cup) ½ cup nutritional yeast. cup fresh basil, finely chopped (optional) 1 tsp fine sea salt. CREAMY VEGAN BROCCOLI CAULIFLOWER SOUP Instructions. Heat oil in a soup pot or Dutch oven over medium heat. Add onion, ½ tsp salt, and a grind of pepper and sauté for 5 minutes, or until softened. Add garlic and cook for another minute. Add carrots, broccoli, cauliflower, and potato and sauté EASY HEALTHY OVERNIGHT STEEL CUT OATMEAL RECIPE How to Make Overnight Steel Cut Oatmeal. Full of fiber, plant protein, and whole grain goodness, Overnight Steel Cut Oatmeal is a GLORIOUS way to start the day, especially when the full Tupperware is ready to go and all you have to do is throw it in HEALTHY PUMPKIN BARS (FLOURLESS, VEGAN & GLUTEN FREE!) Super moist Healthy Pumpkin Bars are the perfect fall treat! One bowl and no flour, butter, or refined sugar. Vegan, gluten free and paleo friendly. Preheat oven to 350F. Spray an 8x8in square baking dish with cooking spray. Place almond butter, pumpkin, banana, COOKING METHOD ARCHIVES Common cooking methods including one pot meals, Instant Pot recipes, healthy baking recipes, no bake snacks, and even 30-minute meals foreasy dinners.
FLUFFY LEMON YOGURT PANCAKES Tips to store, reheat and freeze pancakes. Pancakes reheat and freeze amazingly well. We're talkin' epic breakfast all week long! Make a batch on Sunday and store them in the refrigerator in an air-tight container for easy, healthy breakfasts all week. Simply pop them in the toaster or microwave for 20-30 seconds to warm up before serving.VEGAN ARCHIVES
Vegan Recipes. The best vegan recipes for breakfast, lunch and dinner packed with plant power! Get ready for veggies galore. You'll see plenty of vegan modification options on my recipes, too.SEASON ARCHIVES
Well HELLO there, pal! I'm Alexis. Welcome to Hummusapien, a fantastical food blog brimming with nourishing (always delish!) recipes from a Registered Dietitian plus life tidbits to inspire you to live your most joyful, balanced life. MAPLE BALSAMIC ROASTED BRUSSELS SPROUTS 1 tbsp balsamic vinegar. ½ tsp salt. Pepper, to taste. Optional: toss with ½ cup toasted walnuts and ⅓ cup dried cranberries after cooking for a festive side dish. Instructions. Preheat oven to 375F. Slice off woody ends and slice sprouts in half. Place in a large bowl. Add the rest of the ingredients and toss to coat.BLOG ARCHIVES
[dt_blog_masonry post_type="posts" mode="grid" loading_effect="fade_in" content_bg="n" post_content_paddings="15px 0px 0px 0px" resized_image HOME - HUMMUSAPIENRECIPESWELLNESSLIFESTYLEALCHEMYFAQBREAKFAST Welcome to Hummusapien, a fantastical food blog brimming with nourishing (always delish!) recipes from a Registered Dietitian plus lifestyle tidbits to inspire you to live your most joyful, balanced life. Grab a super hot cup o' joe and let's get cookin'.RECIPES ARCHIVES
Vegan Double Chocolate Cookies. Blueberry Banana Baked Oatmeal. Banana Bread Protein Bars. Top 20 Most-Loved Hummusapien Recipes of All Time. Flourless Apple Cinnamon Muffins. Amazing Minestrone Soup. Mint Chocolate Energy Bites. Sweet Potato Black Bean Burgers with Cilantro Yogurt Sauce. Healthy Morning Glory Muffins. YOUR TOP 10 FAVORITE RECIPES FROM 2020 What. A. Year. In 2020, I canceled my wedding (and honeymoon) twice. got married in my living room. helped launch Alchemy Meal Prep. closed and reopened restaurants. turned 30. got pregnant. had the stomach flu during my virtual baby shower. spent a month in the hospital. cried a lot. THE BEST VEGAN BROCCOLI SALAD EVER Blend until completely smooth and creamy. Place broccoli, grapes, almonds, red onion, and dried cranberries in a medium or large mixing bowl. Add dressing and toss thoroughly to coat. Season with salt and pepper to taste. Serve chilled. The Best Vegan 12 HEALTHY CACAO RECIPES THAT WILL MAKE YOU LOVE YOURSELF I always buy this cacoa powder because it's organic, affordable, and because Terra Soul is a family run company that I love. Now go crazy for cacao with me and make some yummy noms! ONE BOWL VEGAN CHOCOLATE ZUCCHINI BANANA BREAD. CREAMY CHOCOLATE BLUEBERRY SHAKE. FLOURLESS PEANUT BUTTER ZUCCHINI BROWNIES. VEGAN PEPPERMINT CHOCOLATE SKILLET INCREDIBLE VEGAN BANANA BREAD--SUPER MOIST, SIMPLE TO MAKEVEGAN LASAGNA RECIPE HUMMUSAPIENVEGAN CHOCOLATE BANANA BREADVEGAN CHOCOLATE CHUNK BANANA BREADVEGAN CHOCOLATE BREAD RECIPETHE BEST VEGAN LASAGNA HUMMUSAPIENVEGAN BANANA BREAD NO OIL Bake for 1 hour and 10 minutes (1 hour and 15 minutes for maple syrup version), or until a knife comes out clean. If your loaf looks like it's getting too browned, quickly slide a piece of tin foil on top after 50 minutes. Once done, carefully remove from pan FLUFFY ORANGE MUFFINS 2 large eggs, ideally at room temperature. 1 tsp vanilla extract. Instructions. Preheat the oven to 425°F and grease a muffin tin. Stir together flour, sugar, baking powder, and salt in a large mixing bowl. In a medium bowl or liquid measuring cup, whisk together yogurt, oil, orange juice, vanilla, and eggs. CREAMY VEGAN BROCCOLI CAULIFLOWER SOUP Instructions. Heat oil in a soup pot or Dutch oven over medium heat. Add onion, ½ tsp salt, and a grind of pepper and sauté for 5 minutes, or until softened. Add garlic and cook for another minute. Add carrots, broccoli, cauliflower, and potato and sauté EASY HEALTHY OVERNIGHT STEEL CUT OATMEAL RECIPE How to Make Overnight Steel Cut Oatmeal. Full of fiber, plant protein, and whole grain goodness, Overnight Steel Cut Oatmeal is a GLORIOUS way to start the day, especially when the full Tupperware is ready to go and all you have to do is throw it in EASY VEGAN BLACK BEAN BURGERS Place beans in a large bowl. Mash with a potato masher or fork until most beans are broken up, leaving some whole beans in tact. Add breadcrumbs, onion powder, garlic powder, cumin, chili powder, smoked paprika, salt, pepper, sriarcha, and flax mixture. Stir until well combined. Form into 5-6 tightly-packed patties. HOME - HUMMUSAPIENRECIPESWELLNESSLIFESTYLEALCHEMYFAQBREAKFAST Welcome to Hummusapien, a fantastical food blog brimming with nourishing (always delish!) recipes from a Registered Dietitian plus lifestyle tidbits to inspire you to live your most joyful, balanced life. Grab a super hot cup o' joe and let's get cookin'.RECIPES ARCHIVES
Vegan Double Chocolate Cookies. Blueberry Banana Baked Oatmeal. Banana Bread Protein Bars. Top 20 Most-Loved Hummusapien Recipes of All Time. Flourless Apple Cinnamon Muffins. Amazing Minestrone Soup. Mint Chocolate Energy Bites. Sweet Potato Black Bean Burgers with Cilantro Yogurt Sauce. Healthy Morning Glory Muffins. YOUR TOP 10 FAVORITE RECIPES FROM 2020 What. A. Year. In 2020, I canceled my wedding (and honeymoon) twice. got married in my living room. helped launch Alchemy Meal Prep. closed and reopened restaurants. turned 30. got pregnant. had the stomach flu during my virtual baby shower. spent a month in the hospital. cried a lot. THE BEST VEGAN BROCCOLI SALAD EVER Blend until completely smooth and creamy. Place broccoli, grapes, almonds, red onion, and dried cranberries in a medium or large mixing bowl. Add dressing and toss thoroughly to coat. Season with salt and pepper to taste. Serve chilled. The Best Vegan 12 HEALTHY CACAO RECIPES THAT WILL MAKE YOU LOVE YOURSELF I always buy this cacoa powder because it's organic, affordable, and because Terra Soul is a family run company that I love. Now go crazy for cacao with me and make some yummy noms! ONE BOWL VEGAN CHOCOLATE ZUCCHINI BANANA BREAD. CREAMY CHOCOLATE BLUEBERRY SHAKE. FLOURLESS PEANUT BUTTER ZUCCHINI BROWNIES. VEGAN PEPPERMINT CHOCOLATE SKILLET INCREDIBLE VEGAN BANANA BREAD--SUPER MOIST, SIMPLE TO MAKEVEGAN LASAGNA RECIPE HUMMUSAPIENVEGAN CHOCOLATE BANANA BREADVEGAN CHOCOLATE CHUNK BANANA BREADVEGAN CHOCOLATE BREAD RECIPETHE BEST VEGAN LASAGNA HUMMUSAPIENVEGAN BANANA BREAD NO OIL Bake for 1 hour and 10 minutes (1 hour and 15 minutes for maple syrup version), or until a knife comes out clean. If your loaf looks like it's getting too browned, quickly slide a piece of tin foil on top after 50 minutes. Once done, carefully remove from pan FLUFFY ORANGE MUFFINS 2 large eggs, ideally at room temperature. 1 tsp vanilla extract. Instructions. Preheat the oven to 425°F and grease a muffin tin. Stir together flour, sugar, baking powder, and salt in a large mixing bowl. In a medium bowl or liquid measuring cup, whisk together yogurt, oil, orange juice, vanilla, and eggs. CREAMY VEGAN BROCCOLI CAULIFLOWER SOUP Instructions. Heat oil in a soup pot or Dutch oven over medium heat. Add onion, ½ tsp salt, and a grind of pepper and sauté for 5 minutes, or until softened. Add garlic and cook for another minute. Add carrots, broccoli, cauliflower, and potato and sauté EASY HEALTHY OVERNIGHT STEEL CUT OATMEAL RECIPE How to Make Overnight Steel Cut Oatmeal. Full of fiber, plant protein, and whole grain goodness, Overnight Steel Cut Oatmeal is a GLORIOUS way to start the day, especially when the full Tupperware is ready to go and all you have to do is throw it in EASY VEGAN BLACK BEAN BURGERS Place beans in a large bowl. Mash with a potato masher or fork until most beans are broken up, leaving some whole beans in tact. Add breadcrumbs, onion powder, garlic powder, cumin, chili powder, smoked paprika, salt, pepper, sriarcha, and flax mixture. Stir until well combined. Form into 5-6 tightly-packed patties. THE BEST VEGAN LASAGNA 7 - 10 cups marinara sauce (2-2 5oz jars, I like mine saucy!) For the tofu ricotta: 2 - 14 oz pkg extra firm tofu, drained and pressed. 10oz tub roasted garlic hummus ( 1 heaping cup) ½ cup nutritional yeast. cup fresh basil, finely chopped (optional) 1 tsp fine sea salt. CREAMY VEGAN BROCCOLI CAULIFLOWER SOUP Instructions. Heat oil in a soup pot or Dutch oven over medium heat. Add onion, ½ tsp salt, and a grind of pepper and sauté for 5 minutes, or until softened. Add garlic and cook for another minute. Add carrots, broccoli, cauliflower, and potato and sauté EASY HEALTHY OVERNIGHT STEEL CUT OATMEAL RECIPE How to Make Overnight Steel Cut Oatmeal. Full of fiber, plant protein, and whole grain goodness, Overnight Steel Cut Oatmeal is a GLORIOUS way to start the day, especially when the full Tupperware is ready to go and all you have to do is throw it in HEALTHY PUMPKIN BARS (FLOURLESS, VEGAN & GLUTEN FREE!) Super moist Healthy Pumpkin Bars are the perfect fall treat! One bowl and no flour, butter, or refined sugar. Vegan, gluten free and paleo friendly. Preheat oven to 350F. Spray an 8x8in square baking dish with cooking spray. Place almond butter, pumpkin, banana, COOKING METHOD ARCHIVES Common cooking methods including one pot meals, Instant Pot recipes, healthy baking recipes, no bake snacks, and even 30-minute meals foreasy dinners.
FLUFFY LEMON YOGURT PANCAKES Tips to store, reheat and freeze pancakes. Pancakes reheat and freeze amazingly well. We're talkin' epic breakfast all week long! Make a batch on Sunday and store them in the refrigerator in an air-tight container for easy, healthy breakfasts all week. Simply pop them in the toaster or microwave for 20-30 seconds to warm up before serving.VEGAN ARCHIVES
Vegan Recipes. The best vegan recipes for breakfast, lunch and dinner packed with plant power! Get ready for veggies galore. You'll see plenty of vegan modification options on my recipes, too.SEASON ARCHIVES
Well HELLO there, pal! I'm Alexis. Welcome to Hummusapien, a fantastical food blog brimming with nourishing (always delish!) recipes from a Registered Dietitian plus life tidbits to inspire you to live your most joyful, balanced life. MAPLE BALSAMIC ROASTED BRUSSELS SPROUTS 1 tbsp balsamic vinegar. ½ tsp salt. Pepper, to taste. Optional: toss with ½ cup toasted walnuts and ⅓ cup dried cranberries after cooking for a festive side dish. Instructions. Preheat oven to 375F. Slice off woody ends and slice sprouts in half. Place in a large bowl. Add the rest of the ingredients and toss to coat.BLOG ARCHIVES
[dt_blog_masonry post_type="posts" mode="grid" loading_effect="fade_in" content_bg="n" post_content_paddings="15px 0px 0px 0px" resized_image * Skip to primary navigation * Skip to main content* RECIPES
* RECIPE INDEX
* DIET >
* Vegan
* Gluten Free
* Vegetarian
* Dairy Free
* Nut Free
* Grain Free
* METHOD >
* 30 Minute
* One Pot
* No Bake
* Baking
* Instant Pot
* BREAKFAST
* SNACKS
* MAINS
* SOUPS
* SALADS
* DESSERT
* SIDE DISHES
* DRINKS
* SEASON >
* Winter
* Spring
* Summer
* Fall
* HOLIDAY >
* Thanksgiving
* Christmas
* Mother's Day Brunch* Fourth of July
* ROUND UPS
* MAINS
* SNACKS
* DESSERT
* LIFESTYLE
* MOTHERHOOD
* WELLNESS >
* Must Reads
* Lovely Meals Lately* Meal Plans
* HOME DECOR
* TRAVEL
* LIFE
* SHOP
*
NAV SOCIAL MENU
* search...
menu icon
search icon
search...
* HOME
* RECIPE INDEX
* BREAKFAST
* MAINS
* SNACKS
* DESSERT
* LIFESTYLE
* MOTHERHOOD
* SUBSCRIBE
*
×
*
Snacks
*
Breakfast
*
Lunch and Dinner
*
Dessert
THE LATEST
*
Day in the Life With a Four-Month-Old*
Incredible Vegan Banana Bread*
Lovely Meals Lately
*
Mediterranean Chickpea and Farro Salad More recent posts, please!SNACK ON THIS
*
Incredible Vegan Banana Bread*
Banana Zucchini Oatmeal Cups*
The Best Gluten Free Banana Bread*
Banana Bread Protein Bars*
Flourless Apple Cinnamon Muffins*
Mint Chocolate Energy Bites More snack recipes, please! JOIN THE RECIPE CLUB ★ SIGN UP AND GET MY _HEALTHY DINNERS YOU'LL LOVE_ E-BOOK!WHAT'S FOR DINNER?
*
Mediterranean Chickpea and Farro Salad*
Strawberry Balsamic Spinach Salad*
Easy Vegetable Teriyaki Stir Fry*
Portobello Fajitas
*
Amazing Minestrone Soup*
Sweet Potato Black Bean Burgers with Cilantro Yogurt Sauce*
Instant Pot Lentil Soup (Plus Stovetop Version!)*
Cozy Vegan Shepherd's Pie More main recipes, please! DON'T FORGET DESSERT!*
Incredible Vegan Banana Bread*
Peanut Butter Oatmeal Chocolate Chip Cookies*
The Best Gluten Free Banana Bread*
Vegan Double Chocolate Cookies*
The Best Healthy Holiday Treats!*
Raspberry Thumbprint Cookies (Vegan + Gluten Free) More dessert recipes, please! OH HELLO! I'M ALEXIS. Welcome to Hummusapien, a fantastical food blog brimming with nourishing (always delish!) recipes from a Registered Dietitian plus lifestyle tidbits to inspire you to live your most joyful, balanced life. Grab a super hot cup o' joe and let's get cookin'. Let's keep chatting... -------------------------FOOTER
↑ back to top
*
*
*
*
*
*
* BLOG
* ABOUT
* CONTACT
JOIN THE RECIPE CLUB!* FAQ
* POLICIES
* RECIPES
As an Amazon Associate I earn from qualifying purchases. Copyright © Hummusapien LLC 2011-2021 Hummusapien is a registered trademark of Hummusapien LLC.Details
Copyright © 2024 ArchiveBay.com. All rights reserved. Terms of Use | Privacy Policy | DMCA | 2021 | Feedback | Advertising | RSS 2.0