Are you over 18 and want to see adult content?
More Annotations
![A complete backup of trienaldelisboa.com](https://www.archivebay.com/archive2/5f361a04-b737-438e-abf3-c9ad97885a1f.png)
A complete backup of trienaldelisboa.com
Are you over 18 and want to see adult content?
![A complete backup of abcfoxmontana.com](https://www.archivebay.com/archive2/9a56ae6b-8763-4f30-8367-e1d438aee38e.png)
A complete backup of abcfoxmontana.com
Are you over 18 and want to see adult content?
![A complete backup of tramadolcapsules.com](https://www.archivebay.com/archive2/20d4de8e-6baf-444d-bd6b-b3d3cd5b2ba1.png)
A complete backup of tramadolcapsules.com
Are you over 18 and want to see adult content?
![A complete backup of heirloomroses.com](https://www.archivebay.com/archive2/00b00798-bfbd-4081-b53b-514e463854c1.png)
A complete backup of heirloomroses.com
Are you over 18 and want to see adult content?
![A complete backup of lamaisonduchocolat.co.jp](https://www.archivebay.com/archive2/853411bb-93df-4f60-964f-384251ef0a5d.png)
A complete backup of lamaisonduchocolat.co.jp
Are you over 18 and want to see adult content?
![A complete backup of asian-nation.org](https://www.archivebay.com/archive2/bafab487-a0a0-4834-a392-ce913bba7137.png)
A complete backup of asian-nation.org
Are you over 18 and want to see adult content?
Favourite Annotations
![A complete backup of https://parsonsdance.org](https://www.archivebay.com/archive6/images/40af2d1e-d432-4223-a2e7-01524b99c1bd.png)
A complete backup of https://parsonsdance.org
Are you over 18 and want to see adult content?
![A complete backup of https://indiepulsemusic.com](https://www.archivebay.com/archive6/images/95115d00-57c1-470a-b403-5447571e0f9a.png)
A complete backup of https://indiepulsemusic.com
Are you over 18 and want to see adult content?
![A complete backup of https://pcvisit.de](https://www.archivebay.com/archive6/images/adf03c2d-9eff-427f-9f7f-dbf0631af720.png)
A complete backup of https://pcvisit.de
Are you over 18 and want to see adult content?
![A complete backup of https://andorratelecom.ad](https://www.archivebay.com/archive6/images/4c106102-49b5-4db9-b762-156959db7944.png)
A complete backup of https://andorratelecom.ad
Are you over 18 and want to see adult content?
![A complete backup of https://giftblooms.com](https://www.archivebay.com/archive6/images/bad52717-29cd-498b-bed0-834ffc4be059.png)
A complete backup of https://giftblooms.com
Are you over 18 and want to see adult content?
![A complete backup of https://diamond.jp](https://www.archivebay.com/archive6/images/e5a8b5cf-eecc-47ec-aa76-cbfe7d56f3e6.png)
A complete backup of https://diamond.jp
Are you over 18 and want to see adult content?
![A complete backup of https://etoncorp.com](https://www.archivebay.com/archive6/images/685da712-5808-4d7e-9cfd-139d97480ede.png)
A complete backup of https://etoncorp.com
Are you over 18 and want to see adult content?
![A complete backup of https://texniccenter.org](https://www.archivebay.com/archive6/images/e329d03e-a019-47da-94af-fb7ef61b9c61.png)
A complete backup of https://texniccenter.org
Are you over 18 and want to see adult content?
![A complete backup of https://montessori-centr.ru](https://www.archivebay.com/archive6/images/222c7eb5-dd7a-47ed-95db-05c263947a1b.png)
A complete backup of https://montessori-centr.ru
Are you over 18 and want to see adult content?
![A complete backup of https://iovation.com](https://www.archivebay.com/archive6/images/7dd206b3-66fc-41ad-ab41-5e0ba59a48f0.png)
A complete backup of https://iovation.com
Are you over 18 and want to see adult content?
![A complete backup of https://ambervibe.com](https://www.archivebay.com/archive6/images/f09960c3-1251-4199-a5b3-97ab79259c37.png)
A complete backup of https://ambervibe.com
Are you over 18 and want to see adult content?
![A complete backup of https://ds-host.ru](https://www.archivebay.com/archive6/images/640b1c5b-76de-4b88-9937-0ed203419704.png)
A complete backup of https://ds-host.ru
Are you over 18 and want to see adult content?
Text
local rock-scene.
MŪZIKA - A-EUROPA
A-Europa. 23. mai 2014 08:45 · Aptuvenais lasīšanas ilgums - 1 min. JAUNUMS! ARTŪRS DUBOKS vs AINARS VIRGA - MĀJAS. Artūrs Duboks iedzied dziesmu duetā ar Latvijas roka legendu A. Virgu. Klausamies! Dziesma "Mājas" jau ir Muzikālās Bankas topā. Tā kā mīļie A-Eiropas fani! Lūdzam, visus draudzīgi atbalstīt Artūru Duboku MŪZIKA - KOCIŅI - BIOGRĀFIJA The term "punk" was first used in relation to rock music by some American critics in the early 1970s, to describe garage bands andtheir devotees.
DRAUGIEM.LVTRANSLATE THIS PAGE Šajā spēlē var palīdzēt viens otram un sadarboties. Var izpalīdzēt draugam, pabarojot viņa izsalkušos dzīvniekus, palīdzot novākt laikus viņa ražu, pirms tā sapūst un asistējot citos darbos. Zagt spēlē nevar, tāpēc nav ko uztraukties. Gluži otrādi, par visiem labajiem pie AVATARIJA - DRAUGIEM.LVTRANSLATE THIS PAGE Avatarija - Ieej pasaulē, kur tu pats radi noteikumus! Tērzē ar vecajiem draugiem un iegūsti jaunus, ko Draugiem.lv dzīve atklāj Avatarijā! Iemīlies un apprecies vai izmanto iespējas, dzīve ir tas, kas te notiek. Dejo visu nakti klubā, pērc visjaunākos apģērba modeļus un stilīgi iekārto savu dzīvokli. Tas viss ir MŪZIKA - SUPPER (VAKARIŅAS) - BIOGRĀFIJA Aivars Viksna and Janis Egle founded the group Supper in 1980. Translate in Latvian "Vakariņas". In 1988 Supper performed at the inaugural festival for new bands in Latvia, earning the jury’s awards for cleanest sound and best bassist. MŪZIKA - KATERINA - BIOGRĀFIJA Katerina Fedosejeva simply known by her stage name Katerina, is a singer born in Latvia in 28 may 1987. She is the youngest daughter of three, as she also has a brother and a sister. MŪZIKA - R_A_M - BIOGRĀFIJA I’m Hc_Exp_Oldschool_Newcomer Music Producer from Latvia :D At this moment, all my attention is fully devoted to music creation and improving necessary skills to MŪZIKA — DRAUGIEM.LVTRANSLATE THIS PAGE Hardcore Rap / Russian Rap / Underground Rap 10. dec 2009. Folk Rock / Funk Rock 10. dec 2009. Rock 10. dec 2009 MŪZIKA - PO - BIOGRĀFIJA Po (Ante-Rasa / Limetree / Injected Poison Records) Po, real name - Edgars Aizpurs, is a young DJ, producer and promoter from Riga, Latvia, who is dedicated to techno, experimental and MŪZIKA - YGODEH - BIOGRĀFIJA YGODEH bio: “YGODEH” was founded in October of 2009 by Pavel Stepanov aka “Piton” after scrapping his previous symphonic metal band “Disease”, which is reported to be the longest lived metal project in Daugavpils up to now and having a pivotal influence on alocal rock-scene.
MŪZIKA - A-EUROPA
A-Europa. 23. mai 2014 08:45 · Aptuvenais lasīšanas ilgums - 1 min. JAUNUMS! ARTŪRS DUBOKS vs AINARS VIRGA - MĀJAS. Artūrs Duboks iedzied dziesmu duetā ar Latvijas roka legendu A. Virgu. Klausamies! Dziesma "Mājas" jau ir Muzikālās Bankas topā. Tā kā mīļie A-Eiropas fani! Lūdzam, visus draudzīgi atbalstīt Artūru Duboku MŪZIKA - KOCIŅI - BIOGRĀFIJA The term "punk" was first used in relation to rock music by some American critics in the early 1970s, to describe garage bands andtheir devotees.
DRAUGIEM.LVTRANSLATE THIS PAGE Šajā spēlē var palīdzēt viens otram un sadarboties. Var izpalīdzēt draugam, pabarojot viņa izsalkušos dzīvniekus, palīdzot novākt laikus viņa ražu, pirms tā sapūst un asistējot citos darbos. Zagt spēlē nevar, tāpēc nav ko uztraukties. Gluži otrādi, par visiem labajiem pie AVATARIJA - DRAUGIEM.LVTRANSLATE THIS PAGE Avatarija - Ieej pasaulē, kur tu pats radi noteikumus! Tērzē ar vecajiem draugiem un iegūsti jaunus, ko Draugiem.lv dzīve atklāj Avatarijā! Iemīlies un apprecies vai izmanto iespējas, dzīve ir tas, kas te notiek. Dejo visu nakti klubā, pērc visjaunākos apģērba modeļus un stilīgi iekārto savu dzīvokli. Tas viss ir MŪZIKA - PO - BIOGRĀFIJA Po (Ante-Rasa / Limetree / Injected Poison Records) Po, real name - Edgars Aizpurs, is a young DJ, producer and promoter from Riga, Latvia, who is dedicated to techno, experimental and MŪZIKA - DISTANT LIGHT - BIOGRĀFIJA The first real Distant Light show was performed on the 3rd of January of the year 2003. And the line of shows has begun! At the moment of writing of this essay band played live more than 25 times, with shows ranging from small clubs like Saksofons, to bigger venues like Depo, Zero Zone and Roxy clubs, and also on the huge stages behind the eyes and ears of hundreds of listeners, as big bikerMŪZIKA - A-EUROPA
A-Europa. 23. mai 2014 08:45 · Aptuvenais lasīšanas ilgums - 1 min. JAUNUMS! ARTŪRS DUBOKS vs AINARS VIRGA - MĀJAS. Artūrs Duboks iedzied dziesmu duetā ar Latvijas roka legendu A. Virgu. Klausamies! Dziesma "Mājas" jau ir Muzikālās Bankas topā. Tā kā mīļie A-Eiropas fani! Lūdzam, visus draudzīgi atbalstīt Artūru Duboku MŪZIKA - TRUE ILLUSION - BIOGRĀFIJA nevienmeer vis ir takaa izskataas ! what that mean anyway?? .. GENERAL X a baldly furnished roomMŪZIKA - RIZHIKSH
2004 - 2021 SIA Draugiem SPĒLES - IZSTRĀDĀTĀJIEM session_hash: user's draugiem.lv session identification (32 bit positive integer), that allows the application to check if the user's draugiem.lv session is still active. domain: draugiem.lv domain, that the user has opened (usually www.draugiem.lv) After receiving authorization code, the application has to perform authorize API call(Section
MŪZIKA - PANTMERS
Tuvākie pasākumi. Uzaicini sekot mūziķa profilam. Mobilā versija Palīdzība Kontakti Noteikumi Privātums Par mums Darbs 67. © 2004 -2021 SIA Draugiem
BEYOND THE VALLEY OF THE DOLLS Beyond the Valley of the Dolls (1970). Komēdija; Drāma; Trilleris; Režisors: Russ Meyer Rakstnieks: Roger Ebert THE WRECK OF THE MARY DEARE The Wreck of the Mary Deare (1959). Asa sižeta; Drāma; Trilleris; IMDB vērtējums: 6.69 Režisors: Michael Anderson Rakstnieks: EricAmbler
THE WINTER OF THE YEAR WAS WARM The winter of the year was warm (2012). Drāma; IMDB vērtējums: 7.3 Režisors: David ChoMŪZIKA - A-EUROPA
A-Europa vs Seal de Green - V RIGE DEVCHONKI (REMIX 2013) A-Europa. -. music-like. music-bookmark. music-trash. music-play. A-europa vs Dubox creative Ne zhivu remix. MŪZIKA — DRAUGIEM.LVTRANSLATE THIS PAGE Hardcore Rap / Russian Rap / Underground Rap 10. dec 2009. Folk Rock / Funk Rock 10. dec 2009. Rock 10. dec 2009MŪZIKA - A-EUROPA
A-Europa. 23. mai 2014 08:45 · Aptuvenais lasīšanas ilgums - 1 min. JAUNUMS! ARTŪRS DUBOKS vs AINARS VIRGA - MĀJAS. Artūrs Duboks iedzied dziesmu duetā ar Latvijas roka legendu A. Virgu. Klausamies! Dziesma "Mājas" jau ir Muzikālās Bankas topā. Tā kā mīļie A-Eiropas fani! Lūdzam, visus draudzīgi atbalstīt Artūru Duboku HERO DOG: THE JOURNEY HOME Hero Dog: The Journey Home (2021). Piedzīvojumu; (1 vērtējums)THOUSAND PIECES
Thousand Pieces — Kino — draugiem.lv Thousand PiecesSANDS OF IWO JIMA
Sands of Iwo Jima
SHADOW OF A WOMAN
Shadow of a Woman
MĀRTIŅŠ FREIMANIS Pēdējo reizi manīts. 19. mar 2017 15:01 no mobilās versijas. Par mani Galerijas Nav norādīts attiecību statuss Valmiera; V-diena: 10. novembris; PJVT /A-10/THE LITTLE MERMAID
The Little Mermaid
KĀRLIS KADIĶIS
Pēdējo reizi manīts. 20. mai 22:37. Par mani Galerijas Nav norādīts attiecību statuss V-diena: 28. janvārisMŪZIKA - A-EUROPA
A-Europa vs Seal de Green - V RIGE DEVCHONKI (REMIX 2013) A-Europa. -. music-like. music-bookmark. music-trash. music-play. A-europa vs Dubox creative Ne zhivu remix. MŪZIKA — DRAUGIEM.LVTRANSLATE THIS PAGE Hardcore Rap / Russian Rap / Underground Rap 10. dec 2009. Folk Rock / Funk Rock 10. dec 2009. Rock 10. dec 2009MŪZIKA - A-EUROPA
A-Europa. 23. mai 2014 08:45 · Aptuvenais lasīšanas ilgums - 1 min. JAUNUMS! ARTŪRS DUBOKS vs AINARS VIRGA - MĀJAS. Artūrs Duboks iedzied dziesmu duetā ar Latvijas roka legendu A. Virgu. Klausamies! Dziesma "Mājas" jau ir Muzikālās Bankas topā. Tā kā mīļie A-Eiropas fani! Lūdzam, visus draudzīgi atbalstīt Artūru Duboku HERO DOG: THE JOURNEY HOME Hero Dog: The Journey Home (2021). Piedzīvojumu; (1 vērtējums)THOUSAND PIECES
Thousand Pieces — Kino — draugiem.lv Thousand PiecesSANDS OF IWO JIMA
Sands of Iwo Jima
SHADOW OF A WOMAN
Shadow of a Woman
MĀRTIŅŠ FREIMANIS Pēdējo reizi manīts. 19. mar 2017 15:01 no mobilās versijas. Par mani Galerijas Nav norādīts attiecību statuss Valmiera; V-diena: 10. novembris; PJVT /A-10/THE LITTLE MERMAID
The Little Mermaid
KĀRLIS KADIĶIS
Pēdējo reizi manīts. 20. mai 22:37. Par mani Galerijas Nav norādīts attiecību statuss V-diena: 28. janvārisMŪZIKA - A-EUROPA
A-Europa vs Seal de Green - V RIGE DEVCHONKI (REMIX 2013) A-Europa. -. music-like. music-bookmark. music-trash. music-play. A-europa vs Dubox creative Ne zhivu remix. HERO DOG: THE JOURNEY HOME Hero Dog: The Journey Home (2021). Piedzīvojumu; (1 vērtējums)LEGENDS OF THE FALL
Legends of the Fall
SANDS OF IWO JIMA
Sands of Iwo Jima
KĀRLIS KADIĶIS
Pēdējo reizi manīts. 20. mai 22:37. Par mani Galerijas Nav norādīts attiecību statuss V-diena: 28. janvārisKASPARS PODNIEKS
Pēdējo reizi manīts. 6. apr 16:59 no mobilās versijas. Par mani Galerijas Jelgava; V-diena: 9. janvārisTHE OTHER GUYS
The Other Guys
MARKS SILOVSツ
Pēdējo reizi manīts. 22. mai 01:21 no mobilās versijas. Par mani Galerijas Nav norādīts attiecību statuss Jautrs,pozitīvs,kaķmīlošs .BILDES RUNĀ
Draugiem.lv lietotāju foto galerijas – lielākākā fotogrāfijukrātuve Latvijā.
MŪZIKA - SATELLITES LV - JAUNUMI 2004 - 2021 SIA DraugiemDRAUGIEM.LV
Tavs e-pasts. Tava parole. Atcerēties mani MŪZIKA - KATERINA - BIOGRĀFIJA Katerina Fedosejeva simply known by her stage name Katerina, is a singer born in Latvia in 28 may 1987. She is the youngest daughter of three, as she also has a brother and a sister. MŪZIKA - R_A_M - BIOGRĀFIJA I’m Hc_Exp_Oldschool_Newcomer Music Producer from Latvia :D At this moment, all my attention is fully devoted to music creation and improving necessary skills to MŪZIKA - DISTANT LIGHT - BIOGRĀFIJA The first real Distant Light show was performed on the 3rd of January of the year 2003. And the line of shows has begun! At the moment of writing of this essay band played live more than 25 times, with shows ranging from small clubs like Saksofons, to bigger venues like Depo, Zero Zone and Roxy clubs, and also on the huge stages behind the eyes and ears of hundreds of listeners, as big biker MŪZIKA — DRAUGIEM.LVTRANSLATE THIS PAGE Hardcore Rap / Russian Rap / Underground Rap 10. dec 2009. Folk Rock / Funk Rock 10. dec 2009. Rock 10. dec 2009 MŪZIKA - YGODEH - BIOGRĀFIJA YGODEH bio: “YGODEH” was founded in October of 2009 by Pavel Stepanov aka “Piton” after scrapping his previous symphonic metal band “Disease”, which is reported to be the longest lived metal project in Daugavpils up to now and having a pivotal influence on alocal rock-scene.
MŪZIKA - KOCIŅI - BIOGRĀFIJA The term "punk" was first used in relation to rock music by some American critics in the early 1970s, to describe garage bands andtheir devotees.
DRAUGIEM.LV
Avatarija - Ieej pasaulē, kur tu pats radi noteikumus! Tērzē ar vecajiem draugiem un iegūsti jaunus, ko Draugiem.lv dzīve atklāj Avatarijā! Iemīlies un apprecies vai izmanto iespējas, dzīve ir tas, kas te notiek. Dejo visu nakti klubā, pērc visjaunākos apģērba modeļus un stilīgi iekārto savu dzīvokli. Tas viss ir KING OF THE TEXAS RANGERS IMDB vērtējums: 7.4 Režisors: John English William Witney Joseph F. Poland William Lively Rakstnieks: Ronald Davidson Norman S. HallJoseph O'Donnell
THE WINTER OF THE YEAR WAS WARM The winter of the year was warm (2012). Drāma; IMDB vērtējums: 7.3 Režisors: David ChoDRAUGIEM.LV
Tavs e-pasts. Tava parole. Atcerēties mani MŪZIKA - KATERINA - BIOGRĀFIJA Katerina Fedosejeva simply known by her stage name Katerina, is a singer born in Latvia in 28 may 1987. She is the youngest daughter of three, as she also has a brother and a sister. MŪZIKA - R_A_M - BIOGRĀFIJA I’m Hc_Exp_Oldschool_Newcomer Music Producer from Latvia :D At this moment, all my attention is fully devoted to music creation and improving necessary skills to MŪZIKA - DISTANT LIGHT - BIOGRĀFIJA The first real Distant Light show was performed on the 3rd of January of the year 2003. And the line of shows has begun! At the moment of writing of this essay band played live more than 25 times, with shows ranging from small clubs like Saksofons, to bigger venues like Depo, Zero Zone and Roxy clubs, and also on the huge stages behind the eyes and ears of hundreds of listeners, as big biker MŪZIKA — DRAUGIEM.LVTRANSLATE THIS PAGE Hardcore Rap / Russian Rap / Underground Rap 10. dec 2009. Folk Rock / Funk Rock 10. dec 2009. Rock 10. dec 2009 MŪZIKA - YGODEH - BIOGRĀFIJA YGODEH bio: “YGODEH” was founded in October of 2009 by Pavel Stepanov aka “Piton” after scrapping his previous symphonic metal band “Disease”, which is reported to be the longest lived metal project in Daugavpils up to now and having a pivotal influence on alocal rock-scene.
MŪZIKA - KOCIŅI - BIOGRĀFIJA The term "punk" was first used in relation to rock music by some American critics in the early 1970s, to describe garage bands andtheir devotees.
DRAUGIEM.LV
Avatarija - Ieej pasaulē, kur tu pats radi noteikumus! Tērzē ar vecajiem draugiem un iegūsti jaunus, ko Draugiem.lv dzīve atklāj Avatarijā! Iemīlies un apprecies vai izmanto iespējas, dzīve ir tas, kas te notiek. Dejo visu nakti klubā, pērc visjaunākos apģērba modeļus un stilīgi iekārto savu dzīvokli. Tas viss ir KING OF THE TEXAS RANGERS IMDB vērtējums: 7.4 Režisors: John English William Witney Joseph F. Poland William Lively Rakstnieks: Ronald Davidson Norman S. HallJoseph O'Donnell
THE WINTER OF THE YEAR WAS WARM The winter of the year was warm (2012). Drāma; IMDB vērtējums: 7.3 Režisors: David ChoEDIJS FREIJS
Šis lietotājs nav vēlējies saņemt dāvanas ārpus draugu loka! Pēdējo reizi manīts. 16. sep 2020 14:46. Par mani Galerijas 1 Nav norādīts attiecību statuss MŪZIKA - IEVA KĀKULE 2004 - 2021 SIA DraugiemDEBESSKRĀPIS
Skrāpē un laimē visādus labumus - foršas un vēl neredzētasbalvas katru dienu!
MŪZIKA - A-EUROPA
A-Europa. 23. mai 2014 08:45 · Aptuvenais lasīšanas ilgums - 1 min. JAUNUMS! ARTŪRS DUBOKS vs AINARS VIRGA - MĀJAS. Artūrs Duboks iedzied dziesmu duetā ar Latvijas roka legendu A. Virgu. Klausamies! Dziesma "Mājas" jau ir Muzikālās Bankas topā. Tā kā mīļie A-Eiropas fani! Lūdzam, visus draudzīgi atbalstīt Artūru Duboku MARUTA AUDARE(KUPŠE)MOB.26057422 Liepāja; V-diena: 7. jūlijs; Puķkopība - sīpolpuķu audzēšana, tirdzniecībā pēc pieprasījuma. Ir strādāts dārzkopības - puķkopības nozarē . BEZMAKSAS CIGUN NODARBĪBAS JŪRMALĀ 1 attēls • 17. jūl 2012 16:49. Mēs esam radīti veseli un skaisti. Diemžēl, ikdienas dzīves praksē tie iedzimtie resursikaut kur pazūd.
SARAUJ, LATVIJA!
Piedalies prognožu spēlē! EGILS DAMBIS(AMOR VINCIT OMNIA) Zolīte Arviduškas dziesmas.. Kam ap, zem un virs 40, kas vēlas parunāties, rast domubiedrus. Zole Latvieši Anglija + Vācija + Nīderlande + Beļģija + Francija + Skotija Meklēju. Piedāvāju.Ideju darbnīca
LĪVIJA BUKOVSKA.
Šis lietotājs nav vēlējies saņemt dāvanas ārpus draugu loka! Medaļas. Skatīt visas. Pēdējo reizi manīta. 20. mai 15:57 nomobilās versijas
LAURA GARKĀNE
Labākā vieta izklaidei, prāta asināšanai un jaunu attiecību veidošanai. draugiem.lv. Laura Garkāne. 20. jūl 2018 06:55. public. apstiprināja draudzību ar Reini Kristoferu Eizenbārdi, Denny Boitman, Daci Aploku, Ilonu Sosninu un Jāni Auziņu.DRAUGIEM.LV
Tavs e-pasts. Tava parole. Atcerēties mani MŪZIKA - KATERINA - BIOGRĀFIJA Katerina Fedosejeva simply known by her stage name Katerina, is a singer born in Latvia in 28 may 1987. She is the youngest daughter of three, as she also has a brother and a sister. MŪZIKA - R_A_M - BIOGRĀFIJA I’m Hc_Exp_Oldschool_Newcomer Music Producer from Latvia :D At this moment, all my attention is fully devoted to music creation and improving necessary skills to MŪZIKA - DISTANT LIGHT - BIOGRĀFIJA The first real Distant Light show was performed on the 3rd of January of the year 2003. And the line of shows has begun! At the moment of writing of this essay band played live more than 25 times, with shows ranging from small clubs like Saksofons, to bigger venues like Depo, Zero Zone and Roxy clubs, and also on the huge stages behind the eyes and ears of hundreds of listeners, as big biker MŪZIKA — DRAUGIEM.LVTRANSLATE THIS PAGE Hardcore Rap / Russian Rap / Underground Rap 10. dec 2009. Folk Rock / Funk Rock 10. dec 2009. Rock 10. dec 2009 MŪZIKA - YGODEH - BIOGRĀFIJA YGODEH bio: “YGODEH” was founded in October of 2009 by Pavel Stepanov aka “Piton” after scrapping his previous symphonic metal band “Disease”, which is reported to be the longest lived metal project in Daugavpils up to now and having a pivotal influence on alocal rock-scene.
MŪZIKA - KOCIŅI - BIOGRĀFIJA The term "punk" was first used in relation to rock music by some American critics in the early 1970s, to describe garage bands andtheir devotees.
DRAUGIEM.LV
Avatarija - Ieej pasaulē, kur tu pats radi noteikumus! Tērzē ar vecajiem draugiem un iegūsti jaunus, ko Draugiem.lv dzīve atklāj Avatarijā! Iemīlies un apprecies vai izmanto iespējas, dzīve ir tas, kas te notiek. Dejo visu nakti klubā, pērc visjaunākos apģērba modeļus un stilīgi iekārto savu dzīvokli. Tas viss ir KING OF THE TEXAS RANGERS IMDB vērtējums: 7.4 Režisors: John English William Witney Joseph F. Poland William Lively Rakstnieks: Ronald Davidson Norman S. HallJoseph O'Donnell
THE WINTER OF THE YEAR WAS WARM The winter of the year was warm (2012). Drāma; IMDB vērtējums: 7.3 Režisors: David ChoDRAUGIEM.LV
Tavs e-pasts. Tava parole. Atcerēties mani MŪZIKA - KATERINA - BIOGRĀFIJA Katerina Fedosejeva simply known by her stage name Katerina, is a singer born in Latvia in 28 may 1987. She is the youngest daughter of three, as she also has a brother and a sister. MŪZIKA - R_A_M - BIOGRĀFIJA I’m Hc_Exp_Oldschool_Newcomer Music Producer from Latvia :D At this moment, all my attention is fully devoted to music creation and improving necessary skills to MŪZIKA - DISTANT LIGHT - BIOGRĀFIJA The first real Distant Light show was performed on the 3rd of January of the year 2003. And the line of shows has begun! At the moment of writing of this essay band played live more than 25 times, with shows ranging from small clubs like Saksofons, to bigger venues like Depo, Zero Zone and Roxy clubs, and also on the huge stages behind the eyes and ears of hundreds of listeners, as big biker MŪZIKA — DRAUGIEM.LVTRANSLATE THIS PAGE Hardcore Rap / Russian Rap / Underground Rap 10. dec 2009. Folk Rock / Funk Rock 10. dec 2009. Rock 10. dec 2009 MŪZIKA - YGODEH - BIOGRĀFIJA YGODEH bio: “YGODEH” was founded in October of 2009 by Pavel Stepanov aka “Piton” after scrapping his previous symphonic metal band “Disease”, which is reported to be the longest lived metal project in Daugavpils up to now and having a pivotal influence on alocal rock-scene.
MŪZIKA - KOCIŅI - BIOGRĀFIJA The term "punk" was first used in relation to rock music by some American critics in the early 1970s, to describe garage bands andtheir devotees.
DRAUGIEM.LV
Avatarija - Ieej pasaulē, kur tu pats radi noteikumus! Tērzē ar vecajiem draugiem un iegūsti jaunus, ko Draugiem.lv dzīve atklāj Avatarijā! Iemīlies un apprecies vai izmanto iespējas, dzīve ir tas, kas te notiek. Dejo visu nakti klubā, pērc visjaunākos apģērba modeļus un stilīgi iekārto savu dzīvokli. Tas viss ir KING OF THE TEXAS RANGERS IMDB vērtējums: 7.4 Režisors: John English William Witney Joseph F. Poland William Lively Rakstnieks: Ronald Davidson Norman S. HallJoseph O'Donnell
THE WINTER OF THE YEAR WAS WARM The winter of the year was warm (2012). Drāma; IMDB vērtējums: 7.3 Režisors: David ChoEDIJS FREIJS
Šis lietotājs nav vēlējies saņemt dāvanas ārpus draugu loka! Pēdējo reizi manīts. 16. sep 2020 14:46. Par mani Galerijas 1 Nav norādīts attiecību statuss MŪZIKA - IEVA KĀKULE 2004 - 2021 SIA DraugiemDEBESSKRĀPIS
Skrāpē un laimē visādus labumus - foršas un vēl neredzētasbalvas katru dienu!
MŪZIKA - A-EUROPA
A-Europa. 23. mai 2014 08:45 · Aptuvenais lasīšanas ilgums - 1 min. JAUNUMS! ARTŪRS DUBOKS vs AINARS VIRGA - MĀJAS. Artūrs Duboks iedzied dziesmu duetā ar Latvijas roka legendu A. Virgu. Klausamies! Dziesma "Mājas" jau ir Muzikālās Bankas topā. Tā kā mīļie A-Eiropas fani! Lūdzam, visus draudzīgi atbalstīt Artūru Duboku MARUTA AUDARE(KUPŠE)MOB.26057422 Liepāja; V-diena: 7. jūlijs; Puķkopība - sīpolpuķu audzēšana, tirdzniecībā pēc pieprasījuma. Ir strādāts dārzkopības - puķkopības nozarē . BEZMAKSAS CIGUN NODARBĪBAS JŪRMALĀ 1 attēls • 17. jūl 2012 16:49. Mēs esam radīti veseli un skaisti. Diemžēl, ikdienas dzīves praksē tie iedzimtie resursikaut kur pazūd.
SARAUJ, LATVIJA!
Piedalies prognožu spēlē! EGILS DAMBIS(AMOR VINCIT OMNIA) Zolīte Arviduškas dziesmas.. Kam ap, zem un virs 40, kas vēlas parunāties, rast domubiedrus. Zole Latvieši Anglija + Vācija + Nīderlande + Beļģija + Francija + Skotija Meklēju. Piedāvāju.Ideju darbnīca
LĪVIJA BUKOVSKA.
Šis lietotājs nav vēlējies saņemt dāvanas ārpus draugu loka! Medaļas. Skatīt visas. Pēdējo reizi manīta. 20. mai 15:57 nomobilās versijas
LAURA GARKĀNE
Labākā vieta izklaidei, prāta asināšanai un jaunu attiecību veidošanai. draugiem.lv. Laura Garkāne. 20. jūl 2018 06:55. public. apstiprināja draudzību ar Reini Kristoferu Eizenbārdi, Denny Boitman, Daci Aploku, Ilonu Sosninu un Jāni Auziņu. group2pigsort-facerecpigsort-pymkverifiedbirthdaypieminasnamedaysvetkiwalletcolor-user-addcolor-wavecolor-giftcolor-commentumbrellaverified-monocolor-pupoli recommendlikecommentschange-ordergifmusic-addmusic-bookmarkmusic-checkmusic-editmusic-nextmusic-man-patikmusic-likemusic-pausemusic-playmusic-popupmusic-prevmusic-repeatmusic-shufflemusic-trashmusic-volume-highmusic-volume-lowmusic-volume-mutespeakerplaysend-mailpauseinfo-trianglemovieembedlinktargetcheckprivateregisteredfriendspubliclocationtagthumbs-downthumbs-upsmaidspointer-rwpointer-dweditpointer-10pointer-dddpointer-ddwinfo-18info-16add-10edit-14img-crumbsearch-passivearrow-1-riarrow-1-lefotolarrow-linkclose-12external-linkcalendarfavouritediscarrowneredz-activesettingsclose-10bellsearchhomeneredzpointer-ddpaintcategoriesbanweather-clearweather-night-clearweather-cloudweather-hailweather-mostly-cloudweather-night-mostly-cloudweather-partly-cloudweather-night-partly-cloudweather-rainweather-rain-krusaweather-rain-lightningweather-rain-lightning-hardweather-rain-snowweather-wind-dirweather-rain-hardweather-snowedit-addweather-cloudsweather-humidityweather-windweather-tempweather-raindropsweather-pressureweather-rainingreport Mēs izmantojam sīkdatnes. Ja piekrīti, papildus obligātajām sīkdatnēm izvietosim arī sīkdatnes, lai analizētu mājaslapas apmeklējumu un rādītu pielāgotu reklāmu. Sīkdatņu noteikumi.
PiekrītuIestatījumiTavs e-pasts
Tava parole
Atcerēties mani
Ienākt
Aizmirsi paroli? ReģistrētiesVai ienāc ar
Noteikumi Palīdzība Kontakti Reklāma Mobilā versija Izstrādātājiem Darbs65Par mums
2004 - 2021 SIA DraugiemРусскийEnglish
Details
Copyright © 2024 ArchiveBay.com. All rights reserved. Terms of Use | Privacy Policy | DMCA | 2021 | Feedback | Advertising | RSS 2.0